PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000140493
Common NameLOC103425475
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 223aa    MW: 25570.4 Da    PI: 9.1414
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000140493genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM101.98.7e-3257854128
            NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    +e+ewyfF++rd+ky++g r+nrat sgyWkatg+dk+++s +++ vg+kk Lvfy+gr pkg+k+dW+mheyrl
  MDP0000140493   5 GENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYS-ESKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 78 
                    689**************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100541.0041106IPR003441NAC domain
SuperFamilySSF1019412.75E-384106IPR003441NAC domain
PfamPF023651.4E-14878IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
KAEFGENEWY FFTPRDRKYP NGIRPNRATV SGYWKATGTD KAIYSESKYV GVKKALVFYQ  60
GRPPKGVKSD WIMHEYRLGD TRKQQANKQL GSMRLDDWVL CRIYKKRQPG KAYLDXKVEE  120
DEKIEMTTPE TAKXNEEQMM LKFPRTCSIT SLLDMDYLGP MSQLLGDNNS GYDFQSSLAG  180
AGAGHAQMFQ FGEMPNYQTT TDSGKFQAMA QTNVLNHQPW FGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-46110765166NAC domain-containing protein 19
4dul_A3e-46110765166NAC domain-containing protein 19
1ut7_B3e-46110765166NO APICAL MERISTEM PROTEIN
1ut7_A3e-46110765166NO APICAL MERISTEM PROTEIN
1ut4_B3e-46110765166NO APICAL MERISTEM PROTEIN
1ut4_A3e-46110765166NO APICAL MERISTEM PROTEIN
3swp_D3e-46110768169NAC domain-containing protein 19
3swp_C3e-46110768169NAC domain-containing protein 19
3swp_B3e-46110768169NAC domain-containing protein 19
3swp_A3e-46110768169NAC domain-containing protein 19
3swm_D3e-46110768169NAC domain-containing protein 19
3swm_C3e-46110768169NAC domain-containing protein 19
3swm_B3e-46110768169NAC domain-containing protein 19
3swm_A3e-46110768169NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98590.0fruit| leaf| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981270.0KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340319.11e-167PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-75NAC29_ARATH; NAC transcription factor 29
TrEMBLS5R6491e-167S5R649_9R
TrEMBLD9ZJA91e-167D9ZJA9_MALDO; NAC domain class transcription factor
STRINGPOPTR_0008s08850.13e-91(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-77NAC-like, activated by AP3/PI